PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_32232.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 75aa    MW: 8956.37 Da    PI: 11.2001
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_32232.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.32.2e-153173547
                             CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47
                             +r+rr++kNRe+A rsR+R++a++ eLe +  +L++eN++Lkk
  Rsa1.0_32232.1_g00001.1 31 RRQRRMIKNRESAARSRARRQAYTVELELELNQLTEENMKLKK 73
                             79***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.0E-52474IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8292975IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.3E-153073No hitNo description
PfamPF001702.6E-133174IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.81E-113173No hitNo description
PROSITE patternPS0003603449IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
NGRSEQYLTG LNAFRIQKRI IDGPPEILME RRQRRMIKNR ESAARSRARR QAYTVELELE  60
LNQLTEENMK LKKIV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010535682.11e-36PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
RefseqXP_010535683.11e-36PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 1
SwissprotQ8RYD61e-33AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLA0A078F7P71e-43A0A078F7P7_BRANA; BnaCnng04010D protein
STRINGBra019436.1-P2e-34(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116522230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.12e-23bZIP family protein